PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK07876.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 217aa    MW: 24833 Da    PI: 6.2623
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK07876.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.82.6e-18550148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg++++eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++l
        PK07876.1  5 RGKFSQEEEETILNLHSILGNK-WSAIASHLP-GRTDNEIKNFWNTHL 50
                     89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.561154IPR017930Myb domain
SuperFamilySSF466891.87E-15260IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-24255IPR009057Homeodomain-like
SMARTSM007172.4E-17452IPR001005SANT/Myb domain
PfamPF002498.2E-17550IPR001005SANT/Myb domain
CDDcd001671.34E-13750No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
XDIKRGKFSQ EEEETILNLH SILGNKWSAI ASHLPGRTDN EIKNFWNTHL KKKLIQMGID  60
PMTHRPRTDI FSSLPHLIAL ANLKELMDHP WEEHAVRIQA EAVQNMAKLH YLQYLLQPPN  120
NNNNNNLNTS DIETINLLNS LSSSFKDNNN NNSTQTVFDS PHDLFQNPIT TTTTHHNDLI  180
LQSLHDSSLS FAHLPDLKIP CSNDHNNNSN QDDERSX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007047937.16e-83Myb domain protein 93
TrEMBLA0A061DHW07e-83A0A061DHW0_THECC; Myb domain protein 93
STRINGPOPTR_0007s05360.17e-80(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.15e-49myb domain protein 93